R3HCC1,DKFZp564N123
  • R3HCC1,DKFZp564N123

Anti-R3HCC1 Antibody 100ul

Ref: AN-HPA023153-100ul
Anti-R3HCC1

Información del producto

Polyclonal Antibody against Human R3HCC1, Gene description: R3H domain and coiled-coil containing 1, Alternative Gene Names: DKFZp564N123, Validated applications: ICC, IHC, Uniprot ID: Q9Y3T6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name R3HCC1
Gene Description R3H domain and coiled-coil containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence ENDFVHRIQEELDRFLLQKQLSKVLLFPPLSSRLRYLIHRTAENFDLLSSFSVGEGWKRRTVICHQDIRVPSSDGLSGPCRAPASCPSRYHGPRPISNQG
Immunogen ENDFVHRIQEELDRFLLQKQLSKVLLFPPLSSRLRYLIHRTAENFDLLSSFSVGEGWKRRTVICHQDIRVPSSDGLSGPCRAPASCPSRYHGPRPISNQG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp564N123
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y3T6
HTS Code 3002150000
Gene ID 203069
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-R3HCC1 Antibody 100ul

Anti-R3HCC1 Antibody 100ul