MRPL38,HSPC262
  • MRPL38,HSPC262

Anti-MRPL38 Antibody 100ul

Ref: AN-HPA023135-100ul
Anti-MRPL38

Información del producto

Polyclonal Antibody against Human MRPL38, Gene description: mitochondrial ribosomal protein L38, Alternative Gene Names: HSPC262, MGC4810, MRP-L3, RPML3, Validated applications: IHC, WB, Uniprot ID: Q96DV4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MRPL38
Gene Description mitochondrial ribosomal protein L38
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence FHGATFVPRVPLHVAYAVGEDDLMPVYCGNEVTPTEAAQAPEVTYEAEEGSLWTLLLTSLDGHLLEPDAEYLHWLLTNIPGNRVAE
Immunogen FHGATFVPRVPLHVAYAVGEDDLMPVYCGNEVTPTEAAQAPEVTYEAEEGSLWTLLLTSLDGHLLEPDAEYLHWLLTNIPGNRVAE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HSPC262, MGC4810, MRP-L3, RPML3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96DV4
HTS Code 3002150000
Gene ID 64978
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MRPL38 Antibody 100ul

Anti-MRPL38 Antibody 100ul