SLFN11,FLJ34922
  • SLFN11,FLJ34922

Anti-SLFN11 Antibody 100ul

Ref: AN-HPA023030-100ul
Anti-SLFN11

Información del producto

Polyclonal Antibody against Human SLFN11, Gene description: schlafen family member 11, Alternative Gene Names: FLJ34922, Validated applications: ICC, IHC, WB, Uniprot ID: Q7Z7L1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SLFN11
Gene Description schlafen family member 11
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence REVLGCAKENVDPDSLRRKIEQAIYKLPCVHFCQPQRPITFTLKIVDVLKRGELYGYACMIRVNPFCCAVFSEAPNSWI
Immunogen REVLGCAKENVDPDSLRRKIEQAIYKLPCVHFCQPQRPITFTLKIVDVLKRGELYGYACMIRVNPFCCAVFSEAPNSWI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ34922
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z7L1
HTS Code 3002150000
Gene ID 91607
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SLFN11 Antibody 100ul

Anti-SLFN11 Antibody 100ul