C17orf53,MGC3130
  • C17orf53,MGC3130

Anti-C17orf53 Antibody 25ul

Ref: AN-HPA023004-25ul
Anti-C17orf53

Información del producto

Polyclonal Antibody against Human C17orf53, Gene description: chromosome 17 open reading frame 53, Alternative Gene Names: MGC3130, Validated applications: ICC, IHC, Uniprot ID: Q8N3J3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name C17orf53
Gene Description chromosome 17 open reading frame 53
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence EQDEFDKVLASMELEEPGMELECGVSSEAIPILPAQQREGSVLAKKARVVDLSGSCQKGPVPAIHKAGIMSAQDESLDPVIQCRTPRPPLRPGAVGHLPVPTALTVPTQQLHWEVCPQRSPVQALQP
Immunogen EQDEFDKVLASMELEEPGMELECGVSSEAIPILPAQQREGSVLAKKARVVDLSGSCQKGPVPAIHKAGIMSAQDESLDPVIQCRTPRPPLRPGAVGHLPVPTALTVPTQQLHWEVCPQRSPVQALQP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC3130
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N3J3
HTS Code 3002150000
Gene ID 78995
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C17orf53 Antibody 25ul

Anti-C17orf53 Antibody 25ul