CCDC40,CILD15
  • CCDC40,CILD15

Anti-CCDC40 Antibody 100ul

Ref: AN-HPA022974-100ul
Anti-CCDC40

Información del producto

Polyclonal Antibody against Human CCDC40, Gene description: coiled-coil domain containing 40, Alternative Gene Names: CILD15, FAP172, FLJ20753, FLJ32021, KIAA1640, Validated applications: ICC, IHC, Uniprot ID: Q4G0X9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CCDC40
Gene Description coiled-coil domain containing 40
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence SEGEKEGNNESHMVSPPEKDDGQKGEEAVGSTEHPEEVTTQAEAAIEEGEVETEGEAAVEGEEEAVSYGDAESEEEYYYTETSSPE
Immunogen SEGEKEGNNESHMVSPPEKDDGQKGEEAVGSTEHPEEVTTQAEAAIEEGEVETEGEAAVEGEEEAVSYGDAESEEEYYYTETSSPE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CILD15, FAP172, FLJ20753, FLJ32021, KIAA1640
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q4G0X9
HTS Code 3002150000
Gene ID 55036
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CCDC40 Antibody 100ul

Anti-CCDC40 Antibody 100ul