MRPL50,FLJ20493
  • MRPL50,FLJ20493

Anti-MRPL50 Antibody 25ul

Ref: AN-HPA022925-25ul
Anti-MRPL50

Información del producto

Polyclonal Antibody against Human MRPL50, Gene description: mitochondrial ribosomal protein L50, Alternative Gene Names: FLJ20493, MRP-L50, Validated applications: ICC, IHC, WB, Uniprot ID: Q8N5N7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MRPL50
Gene Description mitochondrial ribosomal protein L50
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence MAERSVSGITRRVFMWTVSGTPCREFWSRFRKEKEPVVVETVEEKKEPILVCPPLRSRAYTPPEDLQSRLESYVKEV
Immunogen MAERSVSGITRRVFMWTVSGTPCREFWSRFRKEKEPVVVETVEEKKEPILVCPPLRSRAYTPPEDLQSRLESYVKEV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20493, MRP-L50
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N5N7
HTS Code 3002150000
Gene ID 54534
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MRPL50 Antibody 25ul

Anti-MRPL50 Antibody 25ul