LLGL1,DLG4,HUGL
  • LLGL1,DLG4,HUGL

Anti-LLGL1 Antibody 100ul

Ref: AN-HPA022924-100ul
Anti-LLGL1

Información del producto

Polyclonal Antibody against Human LLGL1, Gene description: lethal giant larvae homolog 1 (Drosophila), Alternative Gene Names: DLG4, HUGL, HUGL-1, LLGL, Validated applications: IHC, WB, Uniprot ID: Q15334, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LLGL1
Gene Description lethal giant larvae homolog 1 (Drosophila)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence FERFSLSARNITEPLCSLDINWPRDATQASYRIRESPKLSQANGTPSILLAPQSLDGSPDPAHSMGPDTPEPPEAALSPMSIDSATSADTTLDTTGDVTVEDVKDFLGSSEESEKNLRNLAEDE
Immunogen FERFSLSARNITEPLCSLDINWPRDATQASYRIRESPKLSQANGTPSILLAPQSLDGSPDPAHSMGPDTPEPPEAALSPMSIDSATSADTTLDTTGDVTVEDVKDFLGSSEESEKNLRNLAEDE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DLG4, HUGL, HUGL-1, LLGL
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15334
HTS Code 3002150000
Gene ID 3996
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-LLGL1 Antibody 100ul

Anti-LLGL1 Antibody 100ul