MPRIP,M-RIP,p116Rip
  • MPRIP,M-RIP,p116Rip

Anti-MPRIP Antibody 100ul

Ref: AN-HPA022901-100ul
Anti-MPRIP

Información del producto

Polyclonal Antibody against Human MPRIP, Gene description: myosin phosphatase Rho interacting protein, Alternative Gene Names: M-RIP, p116Rip, RHOIP3, Validated applications: ICC, IHC, WB, Uniprot ID: Q6WCQ1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MPRIP
Gene Description myosin phosphatase Rho interacting protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence KDAYELEVLLRVKESEIQYLKQEISSLKDELQTALRDKKYASDKYKDIYTELSIAKAKADCDISRLKEQLKAATEALGEKSPDSATVSGYDIMKSKSNPDFLKKDRSCVTRQL
Immunogen KDAYELEVLLRVKESEIQYLKQEISSLKDELQTALRDKKYASDKYKDIYTELSIAKAKADCDISRLKEQLKAATEALGEKSPDSATVSGYDIMKSKSNPDFLKKDRSCVTRQL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names M-RIP, p116Rip, RHOIP3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6WCQ1
HTS Code 3002150000
Gene ID 23164
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MPRIP Antibody 100ul

Anti-MPRIP Antibody 100ul