CDC42BPB,KIAA1124
  • CDC42BPB,KIAA1124

Anti-CDC42BPB Antibody 25ul

Ref: AN-HPA022821-25ul
Anti-CDC42BPB

Información del producto

Polyclonal Antibody against Human CDC42BPB, Gene description: CDC42 binding protein kinase beta (DMPK-like), Alternative Gene Names: KIAA1124, MRCKB, Validated applications: IHC, WB, Uniprot ID: Q9Y5S2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CDC42BPB
Gene Description CDC42 binding protein kinase beta (DMPK-like)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence KSKFSGAVLNVPDTSDNSKKQMLRTRSKRRFVFKVPEEERLQQRREMLRDPELRSKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDST
Immunogen KSKFSGAVLNVPDTSDNSKKQMLRTRSKRRFVFKVPEEERLQQRREMLRDPELRSKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDST
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1124, MRCKB
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y5S2
HTS Code 3002150000
Gene ID 9578
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CDC42BPB Antibody 25ul

Anti-CDC42BPB Antibody 25ul