EGLN1,C1orf12
  • EGLN1,C1orf12

Anti-EGLN1 Antibody 100ul

Ref: AN-HPA022129-100ul
Anti-EGLN1

Información del producto

Polyclonal Antibody against Human EGLN1, Gene description: egl-9 family hypoxia-inducible factor 1, Alternative Gene Names: C1orf12, HIFPH2, PHD2, SM-20, ZMYND6, Validated applications: ICC, IHC, Uniprot ID: Q9GZT9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EGLN1
Gene Description egl-9 family hypoxia-inducible factor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence GICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKING
Immunogen GICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKING
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf12, HIFPH2, PHD2, SM-20, ZMYND6
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9GZT9
HTS Code 3002150000
Gene ID 54583
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EGLN1 Antibody 100ul

Anti-EGLN1 Antibody 100ul