CENPU,CENP-50
  • CENPU,CENP-50

Anti-CENPU Antibody 100ul

Ref: AN-HPA022048-100ul
Anti-CENPU

Información del producto

Polyclonal Antibody against Human CENPU, Gene description: centromere protein U, Alternative Gene Names: CENP-50, CENP-U, KLIP1, MLF1IP, PBIP1, Validated applications: ICC, Uniprot ID: Q71F23, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CENPU
Gene Description centromere protein U
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence EETYETFDPPLHSTAIYADEEEFSKHCGLSLSSTPPGKEAKRSSDTSGNEASEIESVKISAKKPGRKLRPISDDSESIEESDTRRKVKSAEKISTQRHEVIRTTASSELSEKPAESV
Immunogen EETYETFDPPLHSTAIYADEEEFSKHCGLSLSSTPPGKEAKRSSDTSGNEASEIESVKISAKKPGRKLRPISDDSESIEESDTRRKVKSAEKISTQRHEVIRTTASSELSEKPAESV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CENP-50, CENP-U, KLIP1, MLF1IP, PBIP1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q71F23
HTS Code 3002150000
Gene ID 79682
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CENPU Antibody 100ul

Anti-CENPU Antibody 100ul