ARPC5L,ARC16-2
  • ARPC5L,ARC16-2

Anti-ARPC5L Antibody 25ul

Ref: AN-HPA022013-25ul
Anti-ARPC5L

Información del producto

Polyclonal Antibody against Human ARPC5L, Gene description: actin related protein 2/3 complex, subunit 5-like, Alternative Gene Names: ARC16-2, MGC3038, Validated applications: IHC, Uniprot ID: Q9BPX5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ARPC5L
Gene Description actin related protein 2/3 complex, subunit 5-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence NFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV
Immunogen NFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARC16-2, MGC3038
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BPX5
HTS Code 3002150000
Gene ID 81873
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ARPC5L Antibody 25ul

Anti-ARPC5L Antibody 25ul