HS3ST5,3-OST-5
  • HS3ST5,3-OST-5

Anti-HS3ST5 Antibody 100ul

Ref: AN-HPA021823-100ul
Anti-HS3ST5

Información del producto

Polyclonal Antibody against Human HS3ST5, Gene description: heparan sulfate (glucosamine) 3-O-sulfotransferase 5, Alternative Gene Names: 3-OST-5, Validated applications: IHC, WB, Uniprot ID: Q8IZT8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HS3ST5
Gene Description heparan sulfate (glucosamine) 3-O-sulfotransferase 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence DRLQPICPIEGRLGGARTQAEFPLRALQFKRGLLHEFRKGNASKEQVRLHDLVQQLPKAIIIGVRKGGTRALLEMLNLHPAVVKASQEIHF
Immunogen DRLQPICPIEGRLGGARTQAEFPLRALQFKRGLLHEFRKGNASKEQVRLHDLVQQLPKAIIIGVRKGGTRALLEMLNLHPAVVKASQEIHF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 3-OST-5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IZT8
HTS Code 3002150000
Gene ID 222537
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HS3ST5 Antibody 100ul

Anti-HS3ST5 Antibody 100ul