ABCF2,ABC28
  • ABCF2,ABC28

Anti-ABCF2 Antibody 100ul

Ref: AN-HPA021815-100ul
Anti-ABCF2

Información del producto

Polyclonal Antibody against Human ABCF2, Gene description: ATP-binding cassette, sub-family F (GCN20), member 2, Alternative Gene Names: ABC28, EST133090, HUSSY-18, M-ABC1, Validated applications: IHC, WB, Uniprot ID: Q9UG63, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ABCF2
Gene Description ATP-binding cassette, sub-family F (GCN20), member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence NHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILAYKEHLKSKLVDEEPQLTKRTHNVCTLTLASLPRP
Immunogen NHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILAYKEHLKSKLVDEEPQLTKRTHNVCTLTLASLPRP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ABC28, EST133090, HUSSY-18, M-ABC1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UG63
HTS Code 3002150000
Gene ID 10061
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ABCF2 Antibody 100ul

Anti-ABCF2 Antibody 100ul