CENPP,CENP-P
  • CENPP,CENP-P

Anti-CENPP Antibody 100ul

Ref: AN-HPA021787-100ul
Anti-CENPP

Información del producto

Polyclonal Antibody against Human CENPP, Gene description: centromere protein P, Alternative Gene Names: CENP-P, RP11-19J3.3, Validated applications: IHC, WB, Uniprot ID: Q6IPU0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CENPP
Gene Description centromere protein P
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence MDAELAEVRALQAEIAALRRACEDPPAPWEEKSRVQKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFLSTLTGINIRNHSKQTEDLTSTEMTEKSIRKVLQRHRL
Immunogen MDAELAEVRALQAEIAALRRACEDPPAPWEEKSRVQKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFLSTLTGINIRNHSKQTEDLTSTEMTEKSIRKVLQRHRL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CENP-P, RP11-19J3.3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6IPU0
HTS Code 3002150000
Gene ID 401541
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CENPP Antibody 100ul

Anti-CENPP Antibody 100ul