RBM33,DKFZp434D1319
  • RBM33,DKFZp434D1319

Anti-RBM33 Antibody 100ul

Ref: AN-HPA021768-100ul
Anti-RBM33

Información del producto

Polyclonal Antibody against Human RBM33, Gene description: RNA binding motif protein 33, Alternative Gene Names: DKFZp434D1319, DKFZp686F102, MGC20460, PRR8, Validated applications: ICC, IHC, WB, Uniprot ID: Q96EV2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RBM33
Gene Description RNA binding motif protein 33
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications ICC, IHC, WB
Sequence QHPPQHQHHHHHHHLSVPPPPLMPMSQPQFRPHVQTAQPQASSSRMQCPQRQGLRHNTTSQNVSKRPMQQMQPTAPRNSNLREL
Immunogen QHPPQHQHHHHHHHLSVPPPPLMPMSQPQFRPHVQTAQPQASSSRMQCPQRQGLRHNTTSQNVSKRPMQQMQPTAPRNSNLREL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp434D1319, DKFZp686F102, MGC20460, PRR8
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96EV2
HTS Code 3002150000
Gene ID 155435
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RBM33 Antibody 100ul

Anti-RBM33 Antibody 100ul