NT5C,cdN,DNT-1,DNT1
  • NT5C,cdN,DNT-1,DNT1

Anti-NT5C Antibody 100ul

Ref: AN-HPA021581-100ul
Anti-NT5C

Información del producto

Polyclonal Antibody against Human NT5C, Gene description: 5', 3'-nucleotidase, cytosolic, Alternative Gene Names: cdN, DNT-1, DNT1, PN-I, UMPH2, Validated applications: IHC, WB, Uniprot ID: Q8TCD5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NT5C
Gene Description 5', 3'-nucleotidase, cytosolic
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Rat
Applications IHC, WB
Sequence GALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVL
Immunogen GALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names cdN, DNT-1, DNT1, PN-I, UMPH2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TCD5
HTS Code 3002150000
Gene ID 30833
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NT5C Antibody 100ul

Anti-NT5C Antibody 100ul