SCO1,SCOD1
  • SCO1,SCOD1

Anti-SCO1 Antibody 25ul

Ref: AN-HPA021565-25ul
Anti-SCO1

Información del producto

Polyclonal Antibody against Human SCO1, Gene description: SCO1 cytochrome c oxidase assembly protein, Alternative Gene Names: SCOD1, Validated applications: IHC, WB, Uniprot ID: O75880, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SCO1
Gene Description SCO1 cytochrome c oxidase assembly protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence TREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYR
Immunogen TREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names SCOD1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75880
HTS Code 3002150000
Gene ID 6341
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SCO1 Antibody 25ul

Anti-SCO1 Antibody 25ul