SVEP1,bA427L11.3
  • SVEP1,bA427L11.3

Anti-SVEP1 Antibody 100ul

Ref: AN-HPA021520-100ul
Anti-SVEP1

Información del producto

Polyclonal Antibody against Human SVEP1, Gene description: sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1, Alternative Gene Names: bA427L11.3, C9orf13, FLJ13529, POLYDOM, Validated applications: IHC, Uniprot ID: Q4LDE5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SVEP1
Gene Description sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence GDFICTPDNTGVNCTLTCLEGYDFTEGSTDKYYCAYEDGVWKPTYTTEWPDCAKKRFANHGFKSFEMFYKAARCDDTDLMKKFSEAFETTLG
Immunogen GDFICTPDNTGVNCTLTCLEGYDFTEGSTDKYYCAYEDGVWKPTYTTEWPDCAKKRFANHGFKSFEMFYKAARCDDTDLMKKFSEAFETTLG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA427L11.3, C9orf13, FLJ13529, POLYDOM
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q4LDE5
HTS Code 3002150000
Gene ID 79987
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SVEP1 Antibody 100ul

Anti-SVEP1 Antibody 100ul