OSBP2,KIAA1664
  • OSBP2,KIAA1664

Anti-OSBP2 Antibody 100ul

Ref: AN-HPA021514-100ul
Anti-OSBP2

Información del producto

Polyclonal Antibody against Human OSBP2, Gene description: oxysterol binding protein 2, Alternative Gene Names: KIAA1664, ORP-4, ORP4, OSBPL1, Validated applications: ICC, IHC, Uniprot ID: Q969R2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name OSBP2
Gene Description oxysterol binding protein 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence SRKWQRALQYEQEQRVHLEETIEQLAKQHNSLERAFHSAPGRPANPSKSFIEGSLLTPKGEDSEEDEDTEYFDAMEDSTSFITV
Immunogen SRKWQRALQYEQEQRVHLEETIEQLAKQHNSLERAFHSAPGRPANPSKSFIEGSLLTPKGEDSEEDEDTEYFDAMEDSTSFITV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1664, ORP-4, ORP4, OSBPL1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q969R2
HTS Code 3002150000
Gene ID 23762
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-OSBP2 Antibody 100ul

Anti-OSBP2 Antibody 100ul