ENTPD8,NTPDase-8
  • ENTPD8,NTPDase-8

Anti-ENTPD8 Antibody 100ul

Ref: AN-HPA021509-100ul
Anti-ENTPD8

Información del producto

Polyclonal Antibody against Human ENTPD8, Gene description: ectonucleoside triphosphate diphosphohydrolase 8, Alternative Gene Names: NTPDase-8, UNQ2492, Validated applications: ICC, IHC, Uniprot ID: Q5MY95, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ENTPD8
Gene Description ectonucleoside triphosphate diphosphohydrolase 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence SHTSLFLYQWPANKENGTGVVSQALACQVEGPGISSYTSNAAQAGESLQGCLEEALVLIPEAQHRKTPTFLGATAGMRLLSRKNSSQARDIFAAVTQVLGRSPVDFWGAELLAGQAEGAFGWITVNYGLG
Immunogen SHTSLFLYQWPANKENGTGVVSQALACQVEGPGISSYTSNAAQAGESLQGCLEEALVLIPEAQHRKTPTFLGATAGMRLLSRKNSSQARDIFAAVTQVLGRSPVDFWGAELLAGQAEGAFGWITVNYGLG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NTPDase-8, UNQ2492
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5MY95
HTS Code 3002150000
Gene ID 377841
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ENTPD8 Antibody 100ul

Anti-ENTPD8 Antibody 100ul