ELMO3,CED-12,CED12
  • ELMO3,CED-12,CED12

Anti-ELMO3 Antibody 25ul

Ref: AN-HPA021484-25ul
Anti-ELMO3

Información del producto

Polyclonal Antibody against Human ELMO3, Gene description: engulfment and cell motility 3, Alternative Gene Names: CED-12, CED12, ELMO-3, FLJ13824, Validated applications: ICC, IHC, Uniprot ID: Q96BJ8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ELMO3
Gene Description engulfment and cell motility 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence LVKSEVPLDRLLVHLQVMNQQLQTKAMALLTALLQGASPVERKHMLDYLWQRNLRQFIYKNIIHSAAPMGDEMAHHLYVLQALMLGL
Immunogen LVKSEVPLDRLLVHLQVMNQQLQTKAMALLTALLQGASPVERKHMLDYLWQRNLRQFIYKNIIHSAAPMGDEMAHHLYVLQALMLGL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CED-12, CED12, ELMO-3, FLJ13824
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96BJ8
HTS Code 3002150000
Gene ID 79767
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ELMO3 Antibody 25ul

Anti-ELMO3 Antibody 25ul