HSD17B4,DBP,MFE-2
  • HSD17B4,DBP,MFE-2

Anti-HSD17B4 Antibody 100ul

Ref: AN-HPA021479-100ul
Anti-HSD17B4

Información del producto

Polyclonal Antibody against Human HSD17B4, Gene description: hydroxysteroid (17-beta) dehydrogenase 4, Alternative Gene Names: DBP, MFE-2, SDR8C1, Validated applications: IHC, WB, Uniprot ID: P51659, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HSD17B4
Gene Description hydroxysteroid (17-beta) dehydrogenase 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence VNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLV
Immunogen VNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DBP, MFE-2, SDR8C1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P51659
HTS Code 3002150000
Gene ID 3295
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HSD17B4 Antibody 100ul

Anti-HSD17B4 Antibody 100ul