DLG2,chapsyn-110
  • DLG2,chapsyn-110

Anti-DLG2 Antibody 25ul

Ref: AN-HPA021307-25ul
Anti-DLG2

Información del producto

Polyclonal Antibody against Human DLG2, Gene description: discs, large homolog 2 (Drosophila), Alternative Gene Names: chapsyn-110, PPP1R58, PSD-93, PSD93, Validated applications: IHC, Uniprot ID: Q15700, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DLG2
Gene Description discs, large homolog 2 (Drosophila)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KVGKPTTIYMTDPYGPPDITHSYSPPMENHLLSGNNGTLEYKTSLPPISPGRYSPIPKHMLVDDDYTRPPEPVYSTVNKLCDKP
Immunogen KVGKPTTIYMTDPYGPPDITHSYSPPMENHLLSGNNGTLEYKTSLPPISPGRYSPIPKHMLVDDDYTRPPEPVYSTVNKLCDKP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names chapsyn-110, PPP1R58, PSD-93, PSD93
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15700
HTS Code 3002150000
Gene ID 1740
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DLG2 Antibody 25ul

Anti-DLG2 Antibody 25ul