ZNF461,GIOT-1
  • ZNF461,GIOT-1

Anti-ZNF461 Antibody 25ul

Ref: AN-HPA021139-25ul
Anti-ZNF461

Información del producto

Polyclonal Antibody against Human ZNF461, Gene description: zinc finger protein 461, Alternative Gene Names: GIOT-1, MGC33911, Validated applications: ICC, IHC, Uniprot ID: Q8TAF7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZNF461
Gene Description zinc finger protein 461
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence NNFLDNNEATDINADLASRDEPQKLSPKRDIYETELSQWVNMEEFKSHSPERSIFSAIWEGNCHFEQ
Immunogen NNFLDNNEATDINADLASRDEPQKLSPKRDIYETELSQWVNMEEFKSHSPERSIFSAIWEGNCHFEQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GIOT-1, MGC33911
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TAF7
HTS Code 3002150000
Gene ID 92283
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZNF461 Antibody 25ul

Anti-ZNF461 Antibody 25ul