SYCP1,CT8
  • SYCP1,CT8

Anti-SYCP1 Antibody 25ul

Ref: AN-HPA021083-25ul
Anti-SYCP1

Información del producto

Polyclonal Antibody against Human SYCP1, Gene description: synaptonemal complex protein 1, Alternative Gene Names: CT8, HOM-TES-14, SCP1, Validated applications: IHC, Uniprot ID: Q15431, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SYCP1
Gene Description synaptonemal complex protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence TLGGDSTFFKSFNKCTEDDFEFPFAKTNLSKNGENIDSDPALQKVNFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKVSTEAELRQKESKLQENRKIIEAQRKAIQEL
Immunogen TLGGDSTFFKSFNKCTEDDFEFPFAKTNLSKNGENIDSDPALQKVNFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKVSTEAELRQKESKLQENRKIIEAQRKAIQEL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CT8, HOM-TES-14, SCP1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15431
HTS Code 3002150000
Gene ID 6847
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SYCP1 Antibody 25ul

Anti-SYCP1 Antibody 25ul