TECPR1
  • TECPR1

Anti-TECPR1 Antibody 25ul

Ref: AN-HPA021061-25ul
Anti-TECPR1

Información del producto

Polyclonal Antibody against Human TECPR1, Gene description: tectonin beta-propeller repeat containing 1, Alternative Gene Names: DKFZP434B0335, FLJ23419, FLJ90593, KIAA1358, Validated applications: ICC, IHC, Uniprot ID: Q7Z6L1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TECPR1
Gene Description tectonin beta-propeller repeat containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence YWEMCKDSQLEFKRVSATTQCCWGIACDNQVYVYVCASDVPIRRREEAYENQRWNPMGGFCEKLLLSDRWGWSDVSGLQHRPLDRVALPSPHWEWESDWYVDENF
Immunogen YWEMCKDSQLEFKRVSATTQCCWGIACDNQVYVYVCASDVPIRRREEAYENQRWNPMGGFCEKLLLSDRWGWSDVSGLQHRPLDRVALPSPHWEWESDWYVDENF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP434B0335, FLJ23419, FLJ90593, KIAA1358
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z6L1
HTS Code 3002150000
Gene ID 25851
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TECPR1 Antibody 25ul

Anti-TECPR1 Antibody 25ul