SOCS5,CIS6,Cish5
  • SOCS5,CIS6,Cish5

Anti-SOCS5 Antibody 25ul

Ref: AN-HPA020884-25ul
Anti-SOCS5

Información del producto

Polyclonal Antibody against Human SOCS5, Gene description: suppressor of cytokine signaling 5, Alternative Gene Names: CIS6, Cish5, CISH6, KIAA0671, SOCS-5, Validated applications: ICC, IHC, Uniprot ID: O75159, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SOCS5
Gene Description suppressor of cytokine signaling 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence HLIKQHTAPVSPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLGPKLAPGMTEISGDSSAIPQANCDSEEDTTTLCLQSRRQKQRQISGDSHTHVSRQGAWKVHTQI
Immunogen HLIKQHTAPVSPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLGPKLAPGMTEISGDSSAIPQANCDSEEDTTTLCLQSRRQKQRQISGDSHTHVSRQGAWKVHTQI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CIS6, Cish5, CISH6, KIAA0671, SOCS-5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75159
HTS Code 3002150000
Gene ID 9655
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SOCS5 Antibody 25ul

Anti-SOCS5 Antibody 25ul