GUCY1B3,GC-S-beta-1
  • GUCY1B3,GC-S-beta-1

Anti-GUCY1B3 Antibody 25ul

Ref: AN-HPA020870-25ul
Anti-GUCY1B3

Información del producto

Polyclonal Antibody against Human GUCY1B3, Gene description: guanylate cyclase 1, soluble, beta 3, Alternative Gene Names: GC-S-beta-1, GC-SB3, GUC1B3, Validated applications: IHC, WB, Uniprot ID: Q02153, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GUCY1B3
Gene Description guanylate cyclase 1, soluble, beta 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence HALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGII
Immunogen HALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGII
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GC-S-beta-1, GC-SB3, GUC1B3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q02153
HTS Code 3002150000
Gene ID 2983
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GUCY1B3 Antibody 25ul

Anti-GUCY1B3 Antibody 25ul