GFRA3,GFRa-3
  • GFRA3,GFRa-3

Anti-GFRA3 Antibody 25ul

Ref: AN-HPA020731-25ul
Anti-GFRA3

Información del producto

Polyclonal Antibody against Human GFRA3, Gene description: GDNF family receptor alpha 3, Alternative Gene Names: GFRa-3, Validated applications: ICC, IHC, WB, Uniprot ID: O60609, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GFRA3
Gene Description GDNF family receptor alpha 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence LPTESRLMNSCLQARRKCQADPTCSAAYHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACL
Immunogen LPTESRLMNSCLQARRKCQADPTCSAAYHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GFRa-3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60609
HTS Code 3002150000
Gene ID 2676
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GFRA3 Antibody 25ul

Anti-GFRA3 Antibody 25ul