ASAP3,CENTB6,DDEFL1
  • ASAP3,CENTB6,DDEFL1

Anti-ASAP3 Antibody 100ul

Ref: AN-HPA020546-100ul
Anti-ASAP3

Información del producto

Polyclonal Antibody against Human ASAP3, Gene description: ArfGAP with SH3 domain, ankyrin repeat and PH domain 3, Alternative Gene Names: CENTB6, DDEFL1, FLJ20199, UPLC1, Validated applications: ICC, IHC, Uniprot ID: Q8TDY4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ASAP3
Gene Description ArfGAP with SH3 domain, ankyrin repeat and PH domain 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence KKHHKECEELLEQAQAGTFAFPLHVDYSWVISTEPGSDSEEDEEEKRCLLKLPAQAHWASGRLDISNKTYETVASLGAATPQGESEDCPPPLPVKNSSRTLVQGCAR
Immunogen KKHHKECEELLEQAQAGTFAFPLHVDYSWVISTEPGSDSEEDEEEKRCLLKLPAQAHWASGRLDISNKTYETVASLGAATPQGESEDCPPPLPVKNSSRTLVQGCAR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CENTB6, DDEFL1, FLJ20199, UPLC1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TDY4
HTS Code 3002150000
Gene ID 55616
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ASAP3 Antibody 100ul

Anti-ASAP3 Antibody 100ul