ADH4,ADH-2
  • ADH4,ADH-2

Anti-ADH4 Antibody 25ul

Ref: AN-HPA020525-25ul
Anti-ADH4

Información del producto

Polyclonal Antibody against Human ADH4, Gene description: alcohol dehydrogenase 4 (class II), pi polypeptide, Alternative Gene Names: ADH-2, Validated applications: IHC, WB, Uniprot ID: P08319, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ADH4
Gene Description alcohol dehydrogenase 4 (class II), pi polypeptide
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence ALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTFIGVAAGSKGLTVFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALV
Immunogen ALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTFIGVAAGSKGLTVFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ADH-2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P08319
HTS Code 3002150000
Gene ID 127
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ADH4 Antibody 25ul

Anti-ADH4 Antibody 25ul