OSTF1,bA235O14.1
  • OSTF1,bA235O14.1

Anti-OSTF1 Antibody 100ul

Ref: AN-HPA020514-100ul
Anti-OSTF1

Información del producto

Polyclonal Antibody against Human OSTF1, Gene description: osteoclast stimulating factor 1, Alternative Gene Names: bA235O14.1, OSF, SH3P2, Validated applications: ICC, IHC, WB, Uniprot ID: Q92882, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name OSTF1
Gene Description osteoclast stimulating factor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB, IHC
Sequence MSKPPPKPVKPGQVKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQAESIDNP
Immunogen MSKPPPKPVKPGQVKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQAESIDNP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA235O14.1, OSF, SH3P2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92882
HTS Code 3002150000
Gene ID 26578
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-OSTF1 Antibody 100ul

Anti-OSTF1 Antibody 100ul