EXOSC3,CGI-102
  • EXOSC3,CGI-102

Anti-EXOSC3 Antibody 100ul

Ref: AN-HPA020485-100ul
Anti-EXOSC3

Información del producto

Polyclonal Antibody against Human EXOSC3, Gene description: exosome component 3, Alternative Gene Names: CGI-102, hRrp-40, hRrp40p, p10, RRP40, Rrp40p, Validated applications: ICC, IHC, WB, Uniprot ID: Q9NQT5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EXOSC3
Gene Description exosome component 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence VYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKD
Immunogen VYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-102, hRrp-40, hRrp40p, p10, RRP40, Rrp40p
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NQT5
HTS Code 3002150000
Gene ID 51010
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EXOSC3 Antibody 100ul

Anti-EXOSC3 Antibody 100ul