RBM45,DRB1,FLJ44612
  • RBM45,DRB1,FLJ44612

Anti-RBM45 Antibody 25ul

Ref: AN-HPA020448-25ul
Anti-RBM45

Información del producto

Polyclonal Antibody against Human RBM45, Gene description: RNA binding motif protein 45, Alternative Gene Names: DRB1, FLJ44612, Validated applications: ICC, Uniprot ID: Q8IUH3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RBM45
Gene Description RNA binding motif protein 45
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence VDSLDEPPNSRIFLVISKYTPESVLRERFSPFGDIQDIWVVRDKHTKESKGIAFVKFARSSQACRAMEEMHGQCLGPNDTKPIKVFIAQSRSSGSHRDVEDEELTRIFVMIPKSYTEE
Immunogen VDSLDEPPNSRIFLVISKYTPESVLRERFSPFGDIQDIWVVRDKHTKESKGIAFVKFARSSQACRAMEEMHGQCLGPNDTKPIKVFIAQSRSSGSHRDVEDEELTRIFVMIPKSYTEE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DRB1, FLJ44612
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IUH3
HTS Code 3002150000
Gene ID 129831
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RBM45 Antibody 25ul

Anti-RBM45 Antibody 25ul