CLIP2,CLIP,CLIP-115
  • CLIP2,CLIP,CLIP-115

Anti-CLIP2 Antibody 100ul

Ref: AN-HPA020430-100ul
Anti-CLIP2

Información del producto

Polyclonal Antibody against Human CLIP2, Gene description: CAP-GLY domain containing linker protein 2, Alternative Gene Names: CLIP, CLIP-115, CYLN2, KIAA0291, WBSCR3, WBSCR4, WSCR3, WSCR4, Validated applications: IHC, WB, Uniprot ID: Q9UDT6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CLIP2
Gene Description CAP-GLY domain containing linker protein 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence SSSISSVSSVASSVGGRPSRSGLLTETSSRYARKISGTTALQEALKEKQQHIEQLLAERDLERAEVAKATSHICEVEKEIALLKAQHEQYVAEAEEKLQRARLLVESVRKEKVDLSNQLEEERRKVEDLQFRVEEESITKGDLELTTVA
Immunogen SSSISSVSSVASSVGGRPSRSGLLTETSSRYARKISGTTALQEALKEKQQHIEQLLAERDLERAEVAKATSHICEVEKEIALLKAQHEQYVAEAEEKLQRARLLVESVRKEKVDLSNQLEEERRKVEDLQFRVEEESITKGDLELTTVA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CLIP, CLIP-115, CYLN2, KIAA0291, WBSCR3, WBSCR4, WSCR3, WSCR4
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UDT6
HTS Code 3002150000
Gene ID 7461
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CLIP2 Antibody 100ul

Anti-CLIP2 Antibody 100ul