DUSP16,KIAA1700
  • DUSP16,KIAA1700

Anti-DUSP16 Antibody 100ul

Ref: AN-HPA020326-100ul
Anti-DUSP16

Información del producto

Polyclonal Antibody against Human DUSP16, Gene description: dual specificity phosphatase 16, Alternative Gene Names: KIAA1700, MKP-7, MKP7, Validated applications: ICC, IHC, Uniprot ID: Q9BY84, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DUSP16
Gene Description dual specificity phosphatase 16
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence KSETPLSPPCADSATSEAAGQRPVHPASVPSVPSVQPSLLEDSPLVQALSGLHLSADRLEDSNKLKRSFSLDIKSVSYSASMAASLHGFSSSEDALEYYKPSTTLDGTNKLCQFSPVQELSEQTPETSPDKEEASIPKK
Immunogen KSETPLSPPCADSATSEAAGQRPVHPASVPSVPSVQPSLLEDSPLVQALSGLHLSADRLEDSNKLKRSFSLDIKSVSYSASMAASLHGFSSSEDALEYYKPSTTLDGTNKLCQFSPVQELSEQTPETSPDKEEASIPKK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1700, MKP-7, MKP7
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BY84
HTS Code 3002150000
Gene ID 80824
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DUSP16 Antibody 100ul

Anti-DUSP16 Antibody 100ul