AKR1B10,AKR1B11
  • AKR1B10,AKR1B11

Anti-AKR1B10 Antibody 25ul

Ref: AN-HPA020280-25ul
Anti-AKR1B10

Información del producto

Polyclonal Antibody against Human AKR1B10, Gene description: aldo-keto reductase family 1, member B10 (aldose reductase), Alternative Gene Names: AKR1B11, AKR1B12, ALDRLn, ARL-1, ARL1, HIS, HSI, Validated applications: ICC, IHC, WB, Uniprot ID: O60218, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name AKR1B10
Gene Description aldo-keto reductase family 1, member B10 (aldose reductase)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB, IHC
Sequence PTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKAT
Immunogen PTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKAT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AKR1B11, AKR1B12, ALDRLn, ARL-1, ARL1, HIS, HSI
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O60218
HTS Code 3002150000
Gene ID 57016
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-AKR1B10 Antibody 25ul

Anti-AKR1B10 Antibody 25ul