PPIE,CyP-33
  • PPIE,CyP-33

Anti-PPIE Antibody 100ul

Ref: AN-HPA020131-100ul
Anti-PPIE

Información del producto

Polyclonal Antibody against Human PPIE, Gene description: peptidylprolyl isomerase E (cyclophilin E), Alternative Gene Names: CyP-33, MGC111222, MGC3736, Validated applications: IHC, WB, Uniprot ID: Q9UNP9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PPIE
Gene Description peptidylprolyl isomerase E (cyclophilin E)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence EEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKF
Immunogen EEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CyP-33, MGC111222, MGC3736
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UNP9
HTS Code 3002150000
Gene ID 10450
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PPIE Antibody 100ul

Anti-PPIE Antibody 100ul