DUSP8,C11orf81
  • DUSP8,C11orf81

Anti-DUSP8 Antibody 100ul

Ref: AN-HPA020071-100ul
Anti-DUSP8

Información del producto

Polyclonal Antibody against Human DUSP8, Gene description: dual specificity phosphatase 8, Alternative Gene Names: C11orf81, FLJ42958, HB5, HVH-5, Validated applications: ICC, IHC, Uniprot ID: Q13202, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DUSP8
Gene Description dual specificity phosphatase 8
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence SDDAYRFVKDRRPSISPNFNFLGQLLEYERSLKLLAALQGDPGTPSGTPEPPPSPAAGAPLPRLPPPTSESAATGNAAAR
Immunogen SDDAYRFVKDRRPSISPNFNFLGQLLEYERSLKLLAALQGDPGTPSGTPEPPPSPAAGAPLPRLPPPTSESAATGNAAAR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C11orf81, FLJ42958, HB5, HVH-5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13202
HTS Code 3002150000
Gene ID 1850
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DUSP8 Antibody 100ul

Anti-DUSP8 Antibody 100ul