SSH3,FLJ10928
  • SSH3,FLJ10928

Anti-SSH3 Antibody 100ul

Ref: AN-HPA019949-100ul
Anti-SSH3

Información del producto

Polyclonal Antibody against Human SSH3, Gene description: slingshot protein phosphatase 3, Alternative Gene Names: FLJ10928, FLJ20515, Validated applications: ICC, IHC, Uniprot ID: Q8TE77, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SSH3
Gene Description slingshot protein phosphatase 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence MKQYECSLEQALRHVQELRPIARPNPGFLRQLQIYQGILTASRQSHVWEQKVGGVSPEEHPAPEVSTPFPPLPPEPE
Immunogen MKQYECSLEQALRHVQELRPIARPNPGFLRQLQIYQGILTASRQSHVWEQKVGGVSPEEHPAPEVSTPFPPLPPEPE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10928, FLJ20515
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TE77
HTS Code 3002150000
Gene ID 54961
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SSH3 Antibody 100ul

Anti-SSH3 Antibody 100ul