CCAR2,DBC-1,DBC1
  • CCAR2,DBC-1,DBC1

Anti-CCAR2 Antibody 25ul

Ref: AN-HPA019943-25ul
Anti-CCAR2

Información del producto

Polyclonal Antibody against Human CCAR2, Gene description: cell cycle and apoptosis regulator 2, Alternative Gene Names: DBC-1, DBC1, KIAA1967, NET35, Validated applications: IHC, WB, Uniprot ID: Q8N163, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CCAR2
Gene Description cell cycle and apoptosis regulator 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence RSVASNQSEMEFSSLQDMPKELDPSAVLPLDCLLAFVFFDANWCGYLHRRDLERILLTLGIRLSAEQAKQLVSRVVTQNICQYRS
Immunogen RSVASNQSEMEFSSLQDMPKELDPSAVLPLDCLLAFVFFDANWCGYLHRRDLERILLTLGIRLSAEQAKQLVSRVVTQNICQYRS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DBC-1, DBC1, KIAA1967, NET35
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N163
HTS Code 3002150000
Gene ID 57805
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CCAR2 Antibody 25ul

Anti-CCAR2 Antibody 25ul