ACOT13,HT012,THEM2
  • ACOT13,HT012,THEM2

Anti-ACOT13 Antibody 100ul

Ref: AN-HPA019881-100ul
Anti-ACOT13

Información del producto

Polyclonal Antibody against Human ACOT13, Gene description: acyl-CoA thioesterase 13, Alternative Gene Names: HT012, THEM2, Validated applications: ICC, IHC, WB, Uniprot ID: Q9NPJ3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ACOT13
Gene Description acyl-CoA thioesterase 13
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence GAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRHTKHLGN
Immunogen GAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRHTKHLGN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HT012, THEM2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NPJ3
HTS Code 3002150000
Gene ID 55856
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ACOT13 Antibody 100ul

Anti-ACOT13 Antibody 100ul