CBLB,Cbl-b,RNF56
  • CBLB,Cbl-b,RNF56

Anti-CBLB Antibody 25ul

Ref: AN-HPA019880-25ul
Anti-CBLB

Información del producto

Polyclonal Antibody against Human CBLB, Gene description: Cbl proto-oncogene B, E3 ubiquitin protein ligase, Alternative Gene Names: Cbl-b, RNF56, Validated applications: ICC, WB, Uniprot ID: Q13191, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CBLB
Gene Description Cbl proto-oncogene B, E3 ubiquitin protein ligase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence DNRLSRHIHHVESVPSRDPPMPLEAWCPRDVFGTNQLVGCRLLGEGSPKPGITASSNVNGRHSRVGSDPVLMRKHRRHDLPLEGAKVFSNGHLGSEEYDVPPRLSPPPPVTTLLPSIKCTGPLA
Immunogen DNRLSRHIHHVESVPSRDPPMPLEAWCPRDVFGTNQLVGCRLLGEGSPKPGITASSNVNGRHSRVGSDPVLMRKHRRHDLPLEGAKVFSNGHLGSEEYDVPPRLSPPPPVTTLLPSIKCTGPLA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Cbl-b, RNF56
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13191
HTS Code 3002150000
Gene ID 868
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CBLB Antibody 25ul

Anti-CBLB Antibody 25ul