FITM1,FIT1
  • FITM1,FIT1

Anti-FITM1 Antibody 25ul

Ref: AN-HPA019842-25ul
Anti-FITM1

Información del producto

Polyclonal Antibody against Human FITM1, Gene description: fat storage-inducing transmembrane protein 1, Alternative Gene Names: FIT1, Validated applications: IHC, WB, Uniprot ID: A5D6W6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FITM1
Gene Description fat storage-inducing transmembrane protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence RRVAVTARHLSRLVVGAAVWRGAGRAFLLIEDLTGSCFEPLPQGLLLHELPDRRSCLAAGHQWRGYTVSSHTF
Immunogen RRVAVTARHLSRLVVGAAVWRGAGRAFLLIEDLTGSCFEPLPQGLLLHELPDRRSCLAAGHQWRGYTVSSHTF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FIT1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A5D6W6
HTS Code 3002150000
Gene ID 161247
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FITM1 Antibody 25ul

Anti-FITM1 Antibody 25ul