GET4,C7orf20,CEE
  • GET4,C7orf20,CEE

Anti-GET4 Antibody 100ul

Ref: AN-HPA019765-100ul
Anti-GET4

Información del producto

Polyclonal Antibody against Human GET4, Gene description: golgi to ER traffic protein 4 homolog (S. cerevisiae), Alternative Gene Names: C7orf20, CEE, CGI-20, H_NH1244M04.5, TRC35, Validated applications: ICC, IHC, WB, Uniprot ID: Q7L5D6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GET4
Gene Description golgi to ER traffic protein 4 homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence AVDGGKLTVFTVLCEQYQPSLRRDPMYNEYLDRIGQLFFGVPPKQTSSYGGLLGNLLTSLMGSSEQEDGEESPSDGSPIELD
Immunogen AVDGGKLTVFTVLCEQYQPSLRRDPMYNEYLDRIGQLFFGVPPKQTSSYGGLLGNLLTSLMGSSEQEDGEESPSDGSPIELD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C7orf20, CEE, CGI-20, H_NH1244M04.5, TRC35
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7L5D6
HTS Code 3002150000
Gene ID 51608
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GET4 Antibody 100ul

Anti-GET4 Antibody 100ul