BCL7A,BCL7
  • BCL7A,BCL7

Anti-BCL7A Antibody 100ul

Ref: AN-HPA019762-100ul
Anti-BCL7A

Información del producto

Polyclonal Antibody against Human BCL7A, Gene description: B-cell CLL/lymphoma 7A, Alternative Gene Names: BCL7, Validated applications: ICC, WB, Uniprot ID: Q4VC05, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name BCL7A
Gene Description B-cell CLL/lymphoma 7A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence QADGKEHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSE
Immunogen QADGKEHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BCL7
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q4VC05
HTS Code 3002150000
Gene ID 605
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-BCL7A Antibody 100ul

Anti-BCL7A Antibody 100ul