RAB31,Rab22B
  • RAB31,Rab22B

Anti-RAB31 Antibody 100ul

Ref: AN-HPA019717-100ul
Anti-RAB31

Información del producto

Polyclonal Antibody against Human RAB31, Gene description: RAB31, member RAS oncogene family, Alternative Gene Names: Rab22B, Validated applications: IHC, WB, Uniprot ID: Q13636, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RAB31
Gene Description RAB31, member RAS oncogene family
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence LKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC
Immunogen LKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Rab22B
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13636
HTS Code 3002150000
Gene ID 11031
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RAB31 Antibody 100ul

Anti-RAB31 Antibody 100ul