SMU1,BWD,FLJ10805
  • SMU1,BWD,FLJ10805

Anti-SMU1 Antibody 100ul

Ref: AN-HPA019708-100ul
Anti-SMU1

Información del producto

Polyclonal Antibody against Human SMU1, Gene description: smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans), Alternative Gene Names: BWD, FLJ10805, fSAP57, SMU-1, Validated applications: ICC, IHC, WB, Uniprot ID: Q2TAY7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SMU1
Gene Description smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence SIEIESSDVIRLIMQYLKENSLHRALATLQEETTVSLNTVDSIESFVADINSGHWDTVLQAIQSLKLPDKTLIDLYEQVVLELIELRELGAARSLLRQTDPMIML
Immunogen SIEIESSDVIRLIMQYLKENSLHRALATLQEETTVSLNTVDSIESFVADINSGHWDTVLQAIQSLKLPDKTLIDLYEQVVLELIELRELGAARSLLRQTDPMIML
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BWD, FLJ10805, fSAP57, SMU-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q2TAY7
HTS Code 3002150000
Gene ID 55234
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SMU1 Antibody 100ul

Anti-SMU1 Antibody 100ul