POU2F3,Epoc-1,OCT11
  • POU2F3,Epoc-1,OCT11

Anti-POU2F3 Antibody 25ul

Ref: AN-HPA019652-25ul
Anti-POU2F3

Información del producto

Polyclonal Antibody against Human POU2F3, Gene description: POU class 2 homeobox 3, Alternative Gene Names: Epoc-1, OCT11, PLA-1, Skn-1a, Validated applications: IHC, WB, Uniprot ID: Q9UKI9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name POU2F3
Gene Description POU class 2 homeobox 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence LESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQP
Immunogen LESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPAMMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Epoc-1, OCT11, PLA-1, Skn-1a
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UKI9
HTS Code 3002150000
Gene ID 25833
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-POU2F3 Antibody 25ul

Anti-POU2F3 Antibody 25ul